logo
sublogo
You are browsing environment: HUMAN GUT
help

CAZyme Information: MGYG000001308_00765

You are here: Home > Sequence: MGYG000001308_00765

Basic Information | Genomic context | Full Sequence | Enzyme annotations |  CAZy signature domains |  CDD domains | CAZyme hits | PDB hits | Swiss-Prot hits | SignalP and Lipop annotations | TMHMM annotations

Basic Information help

Species Streptococcus infantarius
Lineage Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus infantarius
CAZyme ID MGYG000001308_00765
CAZy Family GH70
CAZyme Description Glucosyltransferase-SI
CAZyme Property
Protein Length CGC Molecular Weight Isoelectric Point
1448 MGYG000001308_3|CGC3 160519.83 4.2659
Genome Property
Genome Assembly ID Genome Size Genome Type Country Continent
MGYG000001308 1925087 Isolate not provided not provided
Gene Location Start: 86497;  End: 90843  Strand: +

Full Sequence      Download help

Enzyme Prediction      help

EC 2.4.1.5 2.4.1.- 2.4.1.140

CAZyme Signature Domains help

Family Start End Evalue family coverage
GH70 291 1094 0 0.9975093399750934

CDD Domains      download full data without filtering help

Cdd ID Domain E-Value qStart qEnd sStart sEnd Domain Description
pfam02324 Glyco_hydro_70 0.0 291 1096 1 804
Glycosyl hydrolase family 70. Members of this family belong to glycosyl hydrolase family 70 Glucosyltransferases or sucrose 6-glycosyl transferases (GTF-S) catalyze the transfer of D-glucopyramnosyl units from sucrose onto acceptor molecules, EC:2.4.1.5. This family roughly corresponds to the N-terminal catalytic domain of the enzyme. Members of this family also contain the Putative cell wall binding domain pfam01473, which corresponds with the C-terminal glucan-binding domain.
TIGR04035 glucan_65_rpt 8.41e-23 1260 1322 1 62
glucan-binding repeat. This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473.
COG5263 COG5263 1.49e-19 1120 1412 49 309
Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].
TIGR04035 glucan_65_rpt 3.41e-19 1325 1387 1 62
glucan-binding repeat. This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473.
COG5263 COG5263 7.13e-19 1117 1348 88 309
Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].

CAZyme Hits      help

Hit ID E-Value Query Start Query End Hit Start Hit End
AEZ62213.1 0.0 1 1448 1 1448
QGX00579.1 0.0 1 1448 1 1449
QGZ27177.1 0.0 1 1448 1 1448
VED91590.1 0.0 1 1442 1 1432
VTS85890.1 0.0 1 1442 1 1432

PDB Hits      download full data without filtering help

Hit ID E-Value Query Start Query End Hit Start Hit End Description
3AIB_A 8.76e-319 240 1084 2 843
CrystalStructure of Glucansucrase [Streptococcus mutans],3AIB_B Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_C Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_D Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_E Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_F Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_G Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_H Crystal Structure of Glucansucrase [Streptococcus mutans],3AIC_A Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_B Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_C Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_D Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_E Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_F Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_G Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_H Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_A Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_B Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_C Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_D Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_E Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_F Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_G Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_H Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans]
3KLK_A 4.18e-277 186 1153 3 972
Crystalstructure of Lactobacillus reuteri N-terminally truncated glucansucrase GTF180 in triclinic apo- form [Limosilactobacillus reuteri],4AYG_A Lactobacillus reuteri N-terminally truncated glucansucrase GTF180 in orthorhombic apo-form [Limosilactobacillus reuteri],4AYG_B Lactobacillus reuteri N-terminally truncated glucansucrase GTF180 in orthorhombic apo-form [Limosilactobacillus reuteri]
3HZ3_A 2.33e-276 186 1153 3 972
Lactobacillusreuteri N-terminally truncated glucansucrase GTF180(D1025N)-sucrose complex [Limosilactobacillus reuteri]
5LFC_A 4.08e-274 200 1147 226 1226
Crystalstructure of Leuconostoc citreum NRRL B-1299 N-terminally truncated dextransucrase DSR-M [Leuconostoc citreum],5LFC_B Crystal structure of Leuconostoc citreum NRRL B-1299 N-terminally truncated dextransucrase DSR-M [Leuconostoc citreum]
5NGY_A 1.04e-273 200 1147 223 1223
Crystalstructure of Leuconostoc citreum NRRL B-1299 dextransucrase DSR-M [Leuconostoc citreum],5NGY_B Crystal structure of Leuconostoc citreum NRRL B-1299 dextransucrase DSR-M [Leuconostoc citreum],5O8L_A Crystal structure of Leuconostoc citreum NRRL B-1299 N-terminally truncated dextransucrase DSR-M in complex with sucrose [Leuconostoc citreum],6HTV_A Crystal structure of Leuconostoc citreum NRRL B-1299 N-terminally truncated dextransucrase DSR-M in complex with isomaltotetraose [Leuconostoc citreum]

Swiss-Prot Hits      download full data without filtering help

Hit ID E-Value Query Start Query End Hit Start Hit End Description
P08987 0.0 180 1439 159 1406
Glucosyltransferase-I OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=gtfB PE=3 SV=3
P11001 0.0 1 1439 1 1456
Glucosyltransferase-I OS=Streptococcus downei OX=1317 GN=gtfI PE=3 SV=1
P13470 0.0 179 1416 183 1411
Glucosyltransferase-SI OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=gtfC PE=1 SV=2
P27470 0.0 1 1439 1 1452
Glucosyltransferase-I OS=Streptococcus downei OX=1317 PE=3 SV=1
P29336 0.0 165 1395 130 1360
Glucosyltransferase-S OS=Streptococcus downei OX=1317 GN=gtfS PE=3 SV=1

SignalP and Lipop Annotations help

This protein is predicted as LIPO

Other SP_Sec_SPI LIPO_Sec_SPII TAT_Tat_SPI TATLIP_Sec_SPII PILIN_Sec_SPIII
0.001449 0.149408 0.848746 0.000168 0.000135 0.000084

TMHMM  Annotations      help

There is no transmembrane helices in MGYG000001308_00765.