Glycosyl hydrolase family 70. Members of this family belong to glycosyl hydrolase family 70 Glucosyltransferases or sucrose 6-glycosyl transferases (GTF-S) catalyze the transfer of D-glucopyramnosyl units from sucrose onto acceptor molecules, EC:2.4.1.5. This family roughly corresponds to the N-terminal catalytic domain of the enzyme. Members of this family also contain the Putative cell wall binding domain pfam01473, which corresponds with the C-terminal glucan-binding domain.

glucan-binding repeat. This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473.

glucan-binding repeat. This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473.

pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].

Crystalstructure of Leuconostoc citreum NRRL B-1299 N-terminally truncated dextransucrase DSR-M [Leuconostoc citreum],5LFC_B Crystal structure of Leuconostoc citreum NRRL B-1299 N-terminally truncated dextransucrase DSR-M [Leuconostoc citreum]

Crystalstructure of Leuconostoc citreum NRRL B-1299 dextransucrase DSR-M [Leuconostoc citreum],5NGY_B Crystal structure of Leuconostoc citreum NRRL B-1299 dextransucrase DSR-M [Leuconostoc citreum],5O8L_A Crystal structure of Leuconostoc citreum NRRL B-1299 N-terminally truncated dextransucrase DSR-M in complex with sucrose [Leuconostoc citreum],6HTV_A Crystal structure of Leuconostoc citreum NRRL B-1299 N-terminally truncated dextransucrase DSR-M in complex with isomaltotetraose [Leuconostoc citreum]

CrystalStructure of Glucansucrase [Streptococcus mutans],3AIB_B Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_C Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_D Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_E Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_F Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_G Crystal Structure of Glucansucrase [Streptococcus mutans],3AIB_H Crystal Structure of Glucansucrase [Streptococcus mutans],3AIC_A Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_B Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_C Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_D Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_E Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_F Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_G Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIC_H Crystal Structure of Glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_A Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_B Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_C Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_D Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_E Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_F Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_G Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans],3AIE_H Crystal Structure of glucansucrase from Streptococcus mutans [Streptococcus mutans]

ChainB, Alternansucrase [Leuconostoc mesenteroides]

ChainA, Alternansucrase [Leuconostoc mesenteroides]

Glucosyltransferase-S OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=gtfD PE=3 SV=3

Glucosyltransferase-I OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=gtfB PE=3 SV=3

Glucosyltransferase-SI OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=gtfC PE=1 SV=2

Glucosyltransferase-I OS=Streptococcus downei OX=1317 GN=gtfI PE=3 SV=1

Glucosyltransferase-I OS=Streptococcus downei OX=1317 PE=3 SV=1